-21%
Путь к Свободе. Добро и Зло. Игра в Дуальность

Путь к Свободе. Добро и Зло. Игра в Дуальность

-Вес: 135
-Ширина упаковки: 130
-Высота упаковки: 12
-Глубина упаковки: 200
-crossborder: False

Добро и Зло - две силы, уживающиеся в человеке и управляющие его поступками. Примиряя эти противоположные полюса, мы видим то, что обычно недоступно глазу. Новая книга Владимира Жикаренцева продолжает исследовать тайны человеческой души и причины происходящих с нами событий.

-17%
Путь к свободе. Добро и Зло - игра в дуальность

Путь к свободе. Добро и Зло - игра в дуальность

-Вес: 175
-Ширина упаковки: 130
-Высота упаковки: 20
-Глубина упаковки: 205
-crossborder: False

\"Добро и Зло\" - одна из важнейших книг известного российского философа, писателя и психолога Владимира Жикаренцева. Добро и Зло - две силы, управляющие нашей жизнью и поступками.

Наш ум привык делить мир на \"хорошо - плохо\", \"я и они\", поэтому мы зачастую не живем, а боремся с Вселенной и людьми. Эта борьба не просто делает нас несчастными.

Она создает вполне реальные проблемы: с деньгами, здоровьем, личной жизнью. Научиться управлять.

.

Товары из категории добро и зло-игра в дуальность
Ясновидящая Дарья. Пророчества грядущего

Ясновидящая Дарья. Пророчества грядущего

-Вес: 297
-Ширина упаковки: 140
-Высота упаковки: 15
-Глубина упаковки: 227
-crossborder: False

Ясновидящая Дарья Миронова является одним из сильнейших экстрасенсов России. В этой книге вы познакомитесь с ее даром, которым она владеет с самого рождения и который позволяет ей заглядывать в самые сокровенные глубины человека.

Многолетний опыт практической магии и помощи людям, которым она делится с вами, позволит решить многие вопросы и проблемы повседневной жизни. Ритуалы и заговоры из этой волшебной книги приведут вас к.

.

Домовой. Хранитель домашнего очага

Домовой. Хранитель домашнего очага

-Вес: 185
-Ширина упаковки: 140
-Высота упаковки: 15
-Глубина упаковки: 210
-crossborder: False

С помощью этой книги, написанной известным астрологом Еленой Мазовой, вы узнаете все о хранителе вашего дома - домовом: как он выглядит, чем его кормить, сколько он живет и как с ним подружиться. Автор дает рекомендации, благодаря которым вы сможете помочь своему домовому улучшить энергетику жизненного пространства, чтобы в вашем доме всегда царили уют, гармония и любовь.

Шаманы России

Шаманы России

-Вес: 380
-Ширина упаковки: 145
-Высота упаковки: 20
-Глубина упаковки: 205
-crossborder: False

Книга посвящена возникновению и развитию шаманизма в России с древности до новейшего периода современной истории. Внимание уделяется различным формам шаманской веры, ее взаимосвязям с иными конфессиями, гонениям на шаманов со стороны политической и религиозной власти, шаманским восстаниям и бунтам. На основании археологических и этнографических материалов, а так же секретных архивных документов СССР и данных нового времени, не.

АУМ. Синтез мистических учений Запада и Востока. Выпуск № 2

АУМ. Синтез мистических учений Запада и Востока. Выпуск № 2

-Вес: 295
-Ширина упаковки: 130
-Высота упаковки: 25
-Глубина упаковки: 200
-crossborder: False

Издание 1990 года. Сохранность хорошая.

Есть люди, и в особенности между учеными всех времен было и есть много таких людей, которые или с чужого голоса, или даже путем собственной мыслительной работы дойдя до известных понятий, уже решительно не в состоянии сойти со своего места. Они не признают для себя возможности никаких ошибок.

Если свидетельства их собственных чувств противоречат их теориям и выводам, - они не хотят ни видеть, ни.

Таро на все случаи жизни. Простое и понятное руководство

Таро на все случаи жизни. Простое и понятное руководство

-Вес: 345
-Ширина упаковки: 140
-Высота упаковки: 30
-Глубина упаковки: 220
-crossborder: False

Эта книга даст вам возможность найти свой собственный подход к Таро. Ее автор, опытная гадалка Мелисса Сайнова, откроет секреты работы с Таро, прояснит практические вопросы, интересующие не только новичков, но и опытных тарологов, развеет основные суеверия и заблуждения, окружающих эту сложную систему.

А главное — поможет выстроить личные отношения с картами — и получить ответы на все вопросы. Здесь вы найдете: • Значения всех карт.

.

Под властью чувств. Шестое чувство. Почувствуй вкус жизни (комплект из 3 книг)

Под властью чувств. Шестое чувство. Почувствуй вкус жизни (комплект из 3 книг)

-Вес: 670
-Ширина упаковки: 175
-Высота упаковки: 35
-Глубина упаковки: 200
-crossborder: False

В данный комплект вошли следующие книги:1. Под властью чувств.

Эмоциям дать волю.2.

Шестое чувство. Защитите себя и близких.

3. Почувствуй вкус жизни.

Как получать от жизни удовольствие, и чтобы ничего за это не было. .

Шипы и розы

Шипы и розы

-Вес: 115
-Ширина упаковки: 150
-Высота упаковки: 5
-Глубина упаковки: 210
-crossborder: False

Издание содержит высказывания и изречения Гуруджи Шри Шайлендры Шармы, записанные его учениками в разное время.

Универсальный семейный сонник

Универсальный семейный сонник

-Вес: 104
-Ширина упаковки: 148
-Высота упаковки: 4
-Глубина упаковки: 210
-crossborder: False

Сны являются неотъемлемой частью человеческой жизни. С древних времен человек пытается растолковать их. Чтобы заглянуть в свое будущее. Со страниц этой книги раскроется универсальная символика снов, понятная и доступная всем членам семьи.

Толкователь снов

Толкователь снов

-Вес: 260
-Ширина упаковки: 125
-Высота упаковки: 25
-Глубина упаковки: 200
-crossborder: False

В стародавние времена сонники были в каждом доме. Обычно их клали в изголовье, а то и просто под подушку, чтобы утром не было нужды искать столь нужную во всех отношениях книгу.

Ведь даже самые невероятные сны, как правило, сбывались, особенно если толковали их люди сведущие, настоящие профессионалы своего дела. #34;Сон правду скажет, да не всякому #34;,- гласит народная мудрость.

Наверное, нет нужды объяснять это изречение. Разгадывать сны.

.

Таро Трансформации. Таро пространства вариантов. Чудо медитации (комплект из 2 книг + DVD-ROM)

Таро Трансформации. Таро пространства вариантов. Чудо медитации (комплект из 2 книг + DVD-ROM)

-Вес: 965
-Ширина упаковки: 155
-Высота упаковки: 95
-Глубина упаковки: 215
-crossborder: False

Более подробную информацию о книгах, вошедших в комплект, вы сможете узнать, пройдя по ссылкам: \"Таро Трансформации. Глубокие прозрения - каждый день (+ 60 карт)\" \"Трансерфинг реальности. Таро пространства вариантов (+ 78 карт)\" \"OSHO: Чудо медитации - Секрет трансформации\"

2 221 ₽
1 753 ₽
OZON.RU
Тибетская книга мертвых

Тибетская книга мертвых

-Вес: 80
-Ширина упаковки: 130
-Высота упаковки: 10
-Глубина упаковки: 200
-crossborder: False

#34;Тибетская книга мертвых #34; была написана великим учителем Падмасамбхавой в VIII или IX веке для индийских и тибетских буддистов. Он скрыл книгу до более поздних времен, и в XIV веке она была найдена известным искателем книжных сокровищ Карма Лингпой.

Книга описывает опыт Промежутка (тиб. бардо), обычно относящийся к состоянию между смертью и новым перерождением, согласно ожиданиям посвященных в особую эзотерическую мандалу.

.

1 553 ₽
1 227 ₽
OZON.RU
Окно возможностей. Взгляд на мир в эпоху перемен глазами всемирно известных ученых, визионеров и исследователей

Окно возможностей. Взгляд на мир в эпоху перемен глазами всемирно известных ученых, визионеров и исследователей

-Вес: 700
-Ширина упаковки: 133
-Высота упаковки: 29
-Глубина упаковки: 203
-crossborder: False

В этом великолепном сборнике статей всемирно известных ученых, визионеров, футурологов, социологов и экофилософов 2012 год предстает не как апокалиптическое пророчество, предрекающее конец света, а как шанс людей на духовное пробуждение - #34;окно возможностей #34;, которые позволят нашему миру, увязшему в алчности и вражде, пережить масштабный эволюционный сдвиг. Человечество вступает на новую территорию, в новый период развития, и эта.

Гадания для всех

Гадания для всех

-Вес: 330
-Ширина упаковки: 170
-Высота упаковки: 30
-Глубина упаковки: 240
-crossborder: False

С древнейших времен люди гадали, пытаясь заглянуть в будущее и узнать свою судьбу. Книга «Гадания для всех» раскрывает удивительный и до конца непознанный мир этой магии.

Читателей ждет встреча не только со старинными приемами русского и цыганского гадания, но и с наиболее известными способами гаданий на картах, на кофейной гуще, на чае, по игральным костям, по афоризмам и пословицам, по снам, именам и т.д.

Книга также подскажет.

Секретная Антарктида, или Русская разведка на Южном полюсе

Секретная Антарктида, или Русская разведка на Южном полюсе

-Вес: 245
-Ширина упаковки: 135
-Высота упаковки: 15
-Глубина упаковки: 205
-crossborder: False

Тайны водятся не только в глубинах истории. Тайны рядом с нами, и лишь тонкая перегородка нашего неведения отделяет их от нас.

Но иногда случай разрушает ее, и тогда мы можем увидеть нечто, что меняет весь мир вокруг. Так случилось и с автором этой книги: Ольга Грейгъ прикоснулась к одной из величайших тайн XX века, казалось бы надежно упрятанной на дно секретных архивов.

Антарктический проект, осуществляемый русскими и немцами в 30-40-е.

Аний

Аний

-Вес: 575
-Ширина упаковки: 180
-Высота упаковки: 20
-Глубина упаковки: 240
-crossborder: False

Лазарь Републикен Ленен, библиофил и хранитель древних рукописей, относился к магии как к высшей науке, обеспечивающей доступ к самым интимным тайнам Вселенной. Эти знания он обобщил в своей единственной книге \"Каббалистическая наука\", вышедшей в свет в 1823 году.

Эта книга призвана помочь людям, увлеченным магией, разобраться в каббалистических принципах магических операций и содержит массу сведений практического характера. В.

.

Магия свечей

Магия свечей

-Вес: 185
-Ширина упаковки: 148
-Высота упаковки: 7
-Глубина упаковки: 210
-crossborder: False

Магия свечей - это книга о том, что является неотъемлемым атрибутом любого магического действия. Насколько важны те или иные свечи? Можно ли их изготовить самостоятельно? Как при помощи магических свечей достичь желаемого? Могут ли магические свечи дать мне то, что хочется? Ответы на эти и другие вопросы вы сможете найти в книге #34;Магия свечей #34;, которая проведет Вас от азов этой древней науки, до ее вершин, позволив Вам на личном.

Блаватская. Вестница Шамбалы

Блаватская. Вестница Шамбалы

-Вес: 295
-Ширина упаковки: 135
-Высота упаковки: 20
-Глубина упаковки: 210
-crossborder: False

Сокровенная магия. Исполнение заветных желаний (комплект из 2 книг)

Сокровенная магия. Исполнение заветных желаний (комплект из 2 книг)

-Вес: 810
-Ширина упаковки: 150
-Высота упаковки: 30
-Глубина упаковки: 220
-crossborder: False

Комплект состоит из двух одинаковых книг. Возможно, вы думаете, что магия - это занятие для избранных, для тех, кто готов дни напролет заучивать заклинания и жить по предписаниям древних ведовских книг.

Если так, то Мия Ом легко и непринужденно убедит вас в обратном. Магия, которая работает, требует от вас соблюдения всего лишь нескольких правил: знать, желать, дерзать и хранить молчание.

В остальном можете полагаться на интуицию и.

Крайон. Как исполнить желания в 2018 году по солнечному календарю

Крайон. Как исполнить желания в 2018 году по солнечному календарю

-Вес: 115
-Ширина упаковки: 130
-Высота упаковки: 15
-Глубина упаковки: 205
-crossborder: False

Эта книга-календарь поможет вам жить так, как должен жить человек на планете Земля, - в гармонии с собой и с мирозданием.Из посланий Крайона вы узнаете, как каждый день делать шаг в наилучшем для себя направлении и наилучшим образом. Как научиться не конфликтовать ни с самим собой, ни с окружающими, ни с природой; как не совершать ошибок, обходить препятствия и легко приходить туда, где вас ждет наивысшее благо и разрешение ваших.

Обереги счастливого дома

Обереги счастливого дома

-Вес: 65
-Ширина упаковки: 110
-Высота упаковки: 10
-Глубина упаковки: 170
-crossborder: False

Обереги должны быть в каждом доме - защитные, волшебные, притягивающие удачу и благополучие. В этой книге - простые рецепты счастья для вас и ваших домочадцев. Вы узнаете: - как подружиться с домовым и смастерить оберег от всех бед своими руками; - как превратить бытовые хлопоты в волшебные ритуалы, чудесным образом меняющие атмосферу вашего жилища; - как сделать свой дом уютным островком гармонии, защищенным от невзгод окружающего.

Уничтожаем зло, возвращаем здоровье. Нетрадиционные способы лечения

Уничтожаем зло, возвращаем здоровье. Нетрадиционные способы лечения

-Вес: 105
-Ширина упаковки: 125
-Высота упаковки: 7
-Глубина упаковки: 200
-crossborder: False

Эта книга откроет вам секрет здоровья, удачи и процветания. Вы узнаете, какое воздействие на нашу жизнь и благополучие оказывают наши мысли и эмоции, как научиться управлять ими, чтобы получить желаемое, как избавиться от зла в любых его проявлениях.

Как с помощью целительной силы трав излечиться от недугов, какие молитвы и заговоры, заключающие в себе мощный энергетический заряд, помогают обрести душевное и физическое исцеление.

.

Заговоры сибирской целительницы-15

Заговоры сибирской целительницы-15

-Вес: 135
-Ширина упаковки: 130
-Высота упаковки: 10
-Глубина упаковки: 200
-crossborder: False

Магические рецепты знаменитой сибирской целительницы Натальи Ивановны Степановой помогли миллионам ее учеников по всей России защититься от воздействия враждебных сил, вернуть здоровье, душевный покой, добиться успеха в делах и вернуть семейное счастье.

Звезды и судьбы 2018. Самый полный гороскоп

Звезды и судьбы 2018. Самый полный гороскоп

-Вес: 586
-Ширина упаковки: 133
-Высота упаковки: 25
-Глубина упаковки: 203
-crossborder: False

Эта книга создана ведущими российскими астрологами, основателями школы Астропсихологии, Ириной и Михаилом Кош. В ней вы найдете ежедневные рекомендации для каждого знака Зодиака, а также подробный прогноз на наступающий 2018 год. В книгу включены графики, с помощью которых вам будет легко определить благоприятные и неблагоприятные фазы для вашего знака. Берите звезды в помощники и претворяйте в реальность свои самые заветные мечты.

Влесова книга

Влесова книга

-Вес: 250
-Ширина упаковки: 145
-Высота упаковки: 10
-Глубина упаковки: 215
-crossborder: False

Литературный (художественный) перевод Влескниги выполнен по изданию: О.В.

Творогов Влесова Книга (\"ВК\", 1990), в: Труды отдела древнерусской литературы т. XLIII (ТОДРЛ, 43), Ленинград, Наука, Ленинградское отд.

, 1990, сс.185-224.

Нумерация дощечек дана по указанному изданию. В заголовках текстов дощечек в скобках после номера дощечки - номер страницы по указанному изданию, далее, в скобках, для возможности сравнения, - нумерация по изд.

\"Влесова.

Meditation for Beginners. The Stress-Free Habit to Eliminate Overwhelm and Burnout

Meditation for Beginners. The Stress-Free Habit to Eliminate Overwhelm and Burnout

-Вес: 75
-Ширина упаковки: 127
-Высота упаковки: 3
-Глубина упаковки: 203
-crossborder: False

Why are monks so wise and peaceful? When… some of them are #34;uneducated #34;? We are living in an unprecedented era right now. We are filled with abundance, given more than ever and yet… people are always stressed out with work and always have #34;not enough time #34;.

What if…Time is an illusion? Wait. It #39;s true, isn #39;t it? Time is indeed an illusion.

Time is nothing but emotions. Who cares about the 24 hours or the 86,400 seconds? It #39;s what we feel about the time that is passing by us that matters.

Meditation for Beginners is a shortcut that is meant for this generation of infinite distractions. You may have #34;tried out #34; meditation before or is completely new to meditation.

It is fine. This book is curated just for you.

#34;Your mind is a powerful things. When you.

.

Occult Investigator. Real Cases from the Files of X-Investigations

Occult Investigator. Real Cases from the Files of X-Investigations

-Вес: 341
-Ширина упаковки: 140
-Высота упаковки: 13
-Глубина упаковки: 216
-crossborder: False

Книга #34;Occult Investigator. Real Cases from the Files of X-Investigations #34;.

Take a Break Self-Meditate. Meditations to Soothe Your Soul . Lift Your Spirit

Take a Break Self-Meditate. Meditations to Soothe Your Soul . Lift Your Spirit

-Вес: 165
-Ширина упаковки: 140
-Высота упаковки: 6
-Глубина упаковки: 216
-crossborder: False

Feeling frazzled, frustrated, or anxious? Seeking a purposeful path to peace and contentment? Often, people look to drugs or alcohol to take away the anxiety and stress. When you feel stretched to your limit, instead of self-medicating, why not try something different? Take a break and self-meditate.

Open to any page in this book. Take a few minutes to go within and listen to your higher self.

Learn to be your own healing source. Allow yourself to soothe your soul and lift your spirit.

Wonders will unfold for you as you connect with your true self. .

Mysticism in the Village

Mysticism in the Village

-Вес: 197
-Ширина упаковки: 140
-Высота упаковки: 7
-Глубина упаковки: 216
-crossborder: False

This is a true story of love and romance. Only one week after marriage engagement, cancer strikes with a death sentence; it can only be stayed by a mystical experience.

Секрет. Люди пути (комплект из 2 книг)

Секрет. Люди пути (комплект из 2 книг)

-Вес: 1200
-Ширина упаковки: 150
-Высота упаковки: 60
-Глубина упаковки: 220
-crossborder: False

Finding God w/o the Church

Finding God w/o the Church

-Вес: 121
-Ширина упаковки: 127
-Высота упаковки: 203
-Глубина упаковки: 5
-crossborder: False

This book has a very simple purpose. That purpose is to allow you to experience a God of your own understanding.

A God that has a unique relationship with you. It only asks you to do a couple of new things.

Have a little bit of willingness to think thoughts you have never thought before and to imagine some things you have never imagined before. This will lead you to a place you have never been before.

Les Civilisations Inconnues (French Edition)

Les Civilisations Inconnues (French Edition)

-Вес: 677
-Ширина упаковки: 148
-Высота упаковки: 25
-Глубина упаковки: 210
-crossborder: False

Эта книга — репринт оригинального издания, созданный на основе электронной копии высокого разрешения, которую очистили и обработали вручную, сохранив структуру и орфографию оригинального издания. Редкие, забытые и малоизвестные книги, изданные с петровских времен до наших дней, вновь доступны в виде печатных книг.

Secrets Revealed. Clairvoyance, Magic and the Reality of Spirits

Secrets Revealed. Clairvoyance, Magic and the Reality of Spirits

-Вес: 209
-Ширина упаковки: 152
-Высота упаковки: 7
-Глубина упаковки: 229
-crossborder: False

This collection of essays and lectures by renowned theosophist and occultist C.W.

Leadbeater provides an educated insider #39;s view not only of clairvoyance and the power of the mind, but also of black magic and white magic, and the perseverance of the spirit after death. Both intellectual and spiritual, Leadbeater #39;s writings attempt to not simply explain these difficult and controversial subjects, but provide context and guidance.

Always stressing the importance of education and training in these areas, he raises them above the conventional wisdom that they are fanciful arts. Secrets Revealed is a must-read for anyone interested in a serious consideration of New Age spiritual practices.

English clergyman turned spiritualist CHARLES WEBSTER LEADBEATER (1854-1934) was ordained as an.

How I Motivated Myself to Succeed

How I Motivated Myself to Succeed

-Вес: 272
-Ширина упаковки: 140
-Высота упаковки: 10
-Глубина упаковки: 216
-crossborder: False

Turn Over All Fears, Leave That Self-doubt Suitcase at the Door, and Get Ready for a Motivational MarathonAfter writing her self-help memoir How I Changed My Life in a Year, award-winning blogger and motivational author Shelley Wilson received so many letters asking how she managed to stay motivated and elicit much-needed change in her life, she knew it was time to share everything she’d learned on her journey so far.How I Motivated Myself to Succeed incorporates fifteen years of research, inspirational tools, techniques, and alternative therapies.

Turning to holistic health in a bid to begin the healing process—physically, emotionally, and spiritually—proved to be a lifesaver for the author: “I’m not a floaty kaftan and bells-on-my-fingers kind of girl. I love pizza, duvet.

.

Lighten Up. For Humanity.s Sake. Navigating Our Souls. Evolution

Lighten Up. For Humanity.s Sake. Navigating Our Souls. Evolution

-Вес: 390
-Ширина упаковки: 152
-Высота упаковки: 13
-Глубина упаковки: 229
-crossborder: False

If you’ve ever woken up on the downside of an emotional mudslide, or lost your true north, then Lighten Up For Humanity’s Sake is for you. With expert guidance Jessica Luxmoore takes you by the hand and, through her own personal accounts, reveals by illuminating the shadow within, that you can plot a course to evolve your soulYour shadow emerges from childhood and shapes your adult life: it is the root of your pain.

Find out why and how to acknowledge it, liberating you to navigate your soul’s evolution with love.Have you encountered someone who turned your world upside down? Did you ask, “Why Me”? Could it have been your twin flame or a soul mate? Discover why your soul is speaking to you now saying: “You’re ready!”Your shadow and relationships are the keys to.

.

Guided By The Light. Following Your Angelic Guides

Guided By The Light. Following Your Angelic Guides

-Вес: 384
-Ширина упаковки: 152
-Высота упаковки: 12
-Глубина упаковки: 229
-crossborder: False

Guided by the Light - Following Your Angelic Guides #34; brought together a variety of people having similar experiences with Angels and Spirit Guides, who wanted to share their divine stories with the rest of the world. This is a beautiful compilation of insights, channeled messages, and Angelic experiences told by intuitives, healers, light workers and everyday people.

 This book is the Vision of Jewels Rafter and her nineteen international co-authors sharing their unique insights and messages about Angelic Guides and their divine energy. A heavenly read that will uplift and inspire you to believe more in the Angelic Realm.

.

Crystal Resonance. High Vibrational Well-Being from the Earth and Beyond

Crystal Resonance. High Vibrational Well-Being from the Earth and Beyond

-Вес: 442
-Ширина упаковки: 152
-Высота упаковки: 229
-Глубина упаковки: 14
-crossborder: False

At our very essence, we are Spirit with limitless tools at our disposal to help navigate this life in physical. Crystal Resonance explores combining gifts from Mother Earth to enhance connection to our innate spark of Divinity, Archangels, and Higher Self and fearlessly embrace a life well lived that is supported by the wonder of All That Is.

.Kerry teaches the synergy and life-enhancing resonance that occurs when we combine specific crystal stones and essences, flower essences, essential oils, and practices to facilitate our reconnection with all that we are.

Kerry feels a deep connection with Spirit and writes personally as she openly shares her own life ‘moments’ with the crystal combinations. Each of us is gifted free will—it is inherent, part of the package when we come forth.

.

She Found A Way. She was unstoppable, not because she didn.t have fear or doubts but because she continued on anyway.

She Found A Way. She was unstoppable, not because she didn.t have fear or doubts but because she continued on anyway.

-Вес: 215
-Ширина упаковки: 152
-Высота упаковки: 7
-Глубина упаковки: 229
-crossborder: False

Are you struggling to find your way in life?Perhaps you are ill, feeling lost, dealing with a marriage breakdown, hating your job, or are exhausted looking to the future of how your life looks. There comes a time in all our lives when we are faced with some sort of adversity.

When we stray too far off course, nature has a way of redirecting us back. Resisting the urge to change will either unfold as a gentle nudge in the right direction or, be a BIG wakeup call.

 The signs of change have been there all along.We tend to ignore them because we feel comfortable with what we know and are afraid of what we do not know.

She Found A Way is a guide that will gently support you through those darker moments in life. The book promotes personal empowerment, change, and renewal.

It will open new.

The A-Z Spiritualism Dictionary

The A-Z Spiritualism Dictionary

-Вес: 275
-Ширина упаковки: 140
-Высота упаковки: 10
-Глубина упаковки: 216
-crossborder: False

Today there is huge public interest in Spiritualism, the psychic world and the field of the paranormal. But as yet there is no clear and authoritative guide to its wide range of terminology.

The Dictionary is a comprehensive guide to the essential terms used in all aspects of Spiritualism and other psychic fields, written in simple everyday language. From important psychics and Spiritualists, to key concepts and terms, this book is an indispensible companion to Spiritualism and beyond, also covering the fields of parapsychology and psychical research in accessible fashion.

Also containing a handy reference list of Spiritualist churches and organisations worldwide. .

Romancing the Chalice

Romancing the Chalice

-Вес: 255
-Ширина упаковки: 127
-Высота упаковки: 11
-Глубина упаковки: 203
-crossborder: False

Книга #34;Romancing the Chalice #34;.

I Learned Today

I Learned Today

-Вес: 164
-Ширина упаковки: 127
-Высота упаковки: 7
-Глубина упаковки: 203
-crossborder: False

Книга #34;I Learned Today #34;.

Rapid and Reliable Analysis

Rapid and Reliable Analysis

-Вес: 133
-Ширина упаковки: 140
-Высота упаковки: 5
-Глубина упаковки: 216
-crossborder: False

Reinhold Ebertin explains his method for rapid and reliable analysis of the natal chart and predictive factors, including the three basic factors used in chart interpretation and forecasting. He begins by explaining the use of midpoints as a valuable tool in both natal and predictive astrology, and how they can identify periods of career success and medical issues.

All of the author #39;s points are illustrated with numerous examples in three basic categories: successful people in a variety of careers; people who experienced major change and transformation in their lives; people who died as the result of accident, suicide, and health factors; and people who experienced major career setbacks. A final section in the book includes twenty-four short examples that indicate successful periods,.

.

Ideal Suggestion Through Mental Photography. A Restorative System for Home and Private Use : Preceded by a Study of the Laws of Mental Healing

Ideal Suggestion Through Mental Photography. A Restorative System for Home and Private Use : Preceded by a Study of the Laws of Mental Healing

-Вес: 283
-Ширина упаковки: 156
-Высота упаковки: 9
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible.

Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures,.

.

Spiritual Fragments

Spiritual Fragments

-Вес: 444
-Ширина упаковки: 156
-Высота упаковки: 14
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible.

Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures,.

.

The Astrologer.s Guide

The Astrologer.s Guide

-Вес: 224
-Ширина упаковки: 140
-Высота упаковки: 8
-Глубина упаковки: 216
-crossborder: False

The Astrologer #39;s Guide was edited and compiled in 1675 by noted astrologer William Lilly. It includes the 146 Considerations of astrologer Guido Bonatus and the choicest aphorisms of the Seven Segments of astrologer Jerom Cardan of Milan.

Translated from the Latin by Henry Coley, The Astrologer #39;s Guide was first published in Englsih in 1886. It includes an introduction by Henry Coley, as well as prefaces from subsequent editors.

The information in this classic astrology book is as valuable as it was when compiled in 1675, and includes references to natal, predictive and horary astrology. .

Someone Please Help Me  - So I Did

Someone Please Help Me - So I Did

-Вес: 215
-Ширина упаковки: 152
-Высота упаковки: 7
-Глубина упаковки: 229
-crossborder: False

“Someone please help me.” Those were the words that I screamed inside my head as I rolled on the floor of my rented box room in the city.

What happened afterward changed everything.Without even realising it at the time, I was saved.

I was not meant to leave this life just yet. I had been spoken to and helped but not by any physical person.

A realization set it. It was my decision, my free will to stay on this Earth and make it the best life possible.

Writing has brought up huge pain and sadness but also a freedom to express what I had kept inside for so long. We fool ourselves by believing we have dealt with everything in the past, it just can’t be talked out of us, or masked by prescription drugs.

It is part of who we are made up of, it is up to us how we choose to see it and.

Belonging. Remembering Ourselves Home

Belonging. Remembering Ourselves Home

-Вес: 417
-Ширина упаковки: 152
-Высота упаковки: 14
-Глубина упаковки: 229
-crossborder: False

2017 Nautilus Award Gold WinnerFeel like you don’t belong? You’re not alone. The world has never been more connected, yet people are lonelier than ever.

Whether we feel unworthy, alienated, or anxious about our place in the world — the absence of belonging is the great silent wound of our times. Most people think of belonging as a mythical place, and they spend a lifetime searching for it in vain.

But what if belonging isn’t a place at all? What if it’s a skill that has been lost or forgotten? With her signature depth and eloquence, Toko-pa maps a path to Belonging from the inside out. Drawing on myth, stories and dreams, she takes us into the origins of our estrangement, reframing exile as a necessary initiation into authenticity.

Then she shares the competencies of belonging:.

La Otra Cara de Santiago de Chile

La Otra Cara de Santiago de Chile

-Вес: 180
-Ширина упаковки: 127
-Высота упаковки: 8
-Глубина упаковки: 203
-crossborder: False

Travel to the last place of the world through paper, ink and images. Explore the culture and the way of life of this remote country called Chile. Live, feel, and enjoy with one copy.

Erfullung

Erfullung

-Вес: 274
-Ширина упаковки: 148
-Высота упаковки: 10
-Глубина упаковки: 210
-crossborder: False

„Erfüllung -Mach das Unmögliche möglich #34; ist die Quintessenz einer über 35 jährigen Erfahrung als Hypnotherapeut und Coach. In diesen Jahren hat sich das physikalisch-wissenschaftliche Weltbild dramatisch verändert und auch die Wege für die seelisch-geistige Befreiung des Menschen.

Das Buch vermittelt die Grundlagen mit denen eine Bewusstseinsveränderung heute erreicht werden kann. Es liefert einen neuen Rahmen, um den Wesenskern des Menschen zu offenbaren.

Dabei führt es den Leser zu seinen begrenzenden Glaubenssystemen und eröffnet ihm Methoden sich dauerhaft von ihnen zu befreien. Hier ist ein erprobter, spiritueller Weg für inneres Wachstum beschrieben, der über alle wissenschaftlichen Aspekte transzendiert.

Der Autor schreibt:„Um Erfüllung in deinem Leben zu.

Zillah, the Child Medium; a Tale of Spiritualism

Zillah, the Child Medium; a Tale of Spiritualism

-Вес: 538
-Ширина упаковки: 156
-Высота упаковки: 17
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible.

Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures,.

.

Lectures On Spiritualism Being A Series Of Lectures On The Phenomena And Philosophy Of Development, Individualism, Spirit, Immortality, Mesmerism, Clairvoyance, Spiritual Manifestations, Christianity, And Progress

Lectures On Spiritualism Being A Series Of Lectures On The Phenomena And Philosophy Of Development, Individualism, Spirit, Immortality, Mesmerism, Clairvoyance, Spiritual Manifestations, Christianity, And Progress

-Вес: 528
-Ширина упаковки: 140
-Высота упаковки: 20
-Глубина упаковки: 216
-crossborder: False

Many of the earliest books, particularly those dating back to the 1900s and before, are now extremely scarce and increasingly expensive. We are republishing these classic works in affordable, high quality, modern editions, using the original text and artwork.

Далее >>>